Placeholder image of a protein
Icon representing a puzzle

2448: Electron Density Reconstruction 88

Closed since almost 2 years ago

Novice Overall Electron Density

Summary

Created
April 18, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is part 2 of the Watson-Crick vs Hoogsteen question posed in Reconstruction Puzzle 84, now starting with a Watson-Crick base pair. Also, a reminder of the useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups

  1. Avatar for 2903_2024 11. 2903_2024 1 pt. 49,614
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,774
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 24,284
  1. Avatar for akaaka 21. akaaka Lv 1 17 pts. 53,132
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 16 pts. 53,096
  3. Avatar for georg137 23. georg137 Lv 1 14 pts. 53,060
  4. Avatar for Bletchley Park 24. Bletchley Park Lv 1 13 pts. 53,039
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 11 pts. 53,030
  6. Avatar for silent gene 26. silent gene Lv 1 10 pts. 53,020
  7. Avatar for g_b 27. g_b Lv 1 9 pts. 52,857
  8. Avatar for alcor29 28. alcor29 Lv 1 8 pts. 52,649
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 7 pts. 52,533
  10. Avatar for Steven Pletsch 30. Steven Pletsch Lv 1 6 pts. 52,516

Comments

grogar7 Lv 1

Frequent errors running trim operation on this puzzle. No DNA segments in selection