Placeholder image of a protein
Icon representing a puzzle

2448: Electron Density Reconstruction 88

Closed since almost 2 years ago

Novice Overall Electron Density

Summary


Created
April 18, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is part 2 of the Watson-Crick vs Hoogsteen question posed in Reconstruction Puzzle 84, now starting with a Watson-Crick base pair. Also, a reminder of the useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for 2903_2024 11. 2903_2024 1 pt. 49,614
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,774
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 24,284

  1. Avatar for Trajan464 31. Trajan464 Lv 1 6 pts. 52,451
  2. Avatar for manu8170 32. manu8170 Lv 1 5 pts. 52,417
  3. Avatar for nicobul 33. nicobul Lv 1 4 pts. 52,383
  4. Avatar for BarrySampson 34. BarrySampson Lv 1 4 pts. 52,359
  5. Avatar for maithra 35. maithra Lv 1 3 pts. 52,124
  6. Avatar for NPrincipi 36. NPrincipi Lv 1 3 pts. 51,896
  7. Avatar for kitsoune 37. kitsoune Lv 1 3 pts. 51,839
  8. Avatar for hada 38. hada Lv 1 2 pts. 51,810
  9. Avatar for Deleted player 39. Deleted player pts. 51,793
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 2 pts. 51,785

Comments


grogar7 Lv 1

Frequent errors running trim operation on this puzzle. No DNA segments in selection