Placeholder image of a protein
Icon representing a puzzle

2448: Electron Density Reconstruction 88

Closed since almost 2 years ago

Novice Overall Electron Density

Summary


Created
April 18, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is part 2 of the Watson-Crick vs Hoogsteen question posed in Reconstruction Puzzle 84, now starting with a Watson-Crick base pair. Also, a reminder of the useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for 2903_2024 11. 2903_2024 1 pt. 49,614
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,774
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 24,284

  1. Avatar for Larini 41. Larini Lv 1 2 pts. 51,552
  2. Avatar for murasame 42. murasame Lv 1 2 pts. 51,314
  3. Avatar for Di_Gram 43. Di_Gram Lv 1 1 pt. 51,237
  4. Avatar for zbp 44. zbp Lv 1 1 pt. 51,086
  5. Avatar for carxo 45. carxo Lv 1 1 pt. 50,381
  6. Avatar for Dr.Sillem 46. Dr.Sillem Lv 1 1 pt. 50,336
  7. Avatar for alyssa_d_V2.0 47. alyssa_d_V2.0 Lv 1 1 pt. 49,958
  8. Avatar for pfirth 48. pfirth Lv 1 1 pt. 49,877
  9. Avatar for Jenot96 49. Jenot96 Lv 1 1 pt. 49,873
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 49,706

Comments


grogar7 Lv 1

Frequent errors running trim operation on this puzzle. No DNA segments in selection