Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Villanova ChE 11. Villanova ChE 1 pt. 0
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 43,169
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 43,163
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 87 pts. 43,141
  4. Avatar for Punzi Baker 3 4. Punzi Baker 3 Lv 1 81 pts. 43,066
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 75 pts. 42,997
  6. Avatar for Galaxie 6. Galaxie Lv 1 69 pts. 42,972
  7. Avatar for MicElephant 7. MicElephant Lv 1 64 pts. 42,817
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 59 pts. 42,811
  9. Avatar for BackBuffer 9. BackBuffer Lv 1 55 pts. 42,803
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 50 pts. 42,789

Comments