Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 43,169
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 43,163
  3. Avatar for Go Science 3. Go Science 37 pts. 43,141
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 42,997
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 42,686
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 42,082
  7. Avatar for Australia 7. Australia 2 pts. 42,041
  8. Avatar for VeFold 8. VeFold 1 pt. 40,884
  9. Avatar for Russian team 9. Russian team 1 pt. 40,676
  10. Avatar for 2903_2024 10. 2903_2024 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 43,147
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 24 pts. 43,140
  3. Avatar for Galaxie 3. Galaxie Lv 1 4 pts. 43,118
  4. Avatar for alcor29 4. alcor29 Lv 1 1 pt. 43,069
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 1 pt. 43,016

Comments