Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 43,169
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 43,163
  3. Avatar for Go Science 3. Go Science 37 pts. 43,141
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 42,997
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 42,686
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 42,082
  7. Avatar for Australia 7. Australia 2 pts. 42,041
  8. Avatar for VeFold 8. VeFold 1 pt. 40,884
  9. Avatar for Russian team 9. Russian team 1 pt. 40,676
  10. Avatar for 2903_2024 10. 2903_2024 1 pt. 0
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 46 pts. 42,720
  2. Avatar for jausmh 12. jausmh Lv 1 42 pts. 42,686
  3. Avatar for drjr 13. drjr Lv 1 39 pts. 42,644
  4. Avatar for gmn 14. gmn Lv 1 36 pts. 42,483
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 33 pts. 42,425
  6. Avatar for g_b 16. g_b Lv 1 30 pts. 42,414
  7. Avatar for blazegeek 17. blazegeek Lv 1 27 pts. 42,289
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 25 pts. 42,082
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 23 pts. 42,074
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 20 pts. 42,041

Comments