Placeholder image of a protein
Icon representing a puzzle

2454: Electron Density Reconstruction 90

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
May 02, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS. CTATGTAAACAAC. GTTGTTTACATAG

Top groups


  1. Avatar for SHELL 11. SHELL 1 pt. 0

  1. Avatar for jausmh 11. jausmh Lv 1 43 pts. 37,343
  2. Avatar for BackBuffer 12. BackBuffer Lv 1 39 pts. 37,308
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 36 pts. 37,225
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 33 pts. 37,223
  5. Avatar for grogar7 15. grogar7 Lv 1 30 pts. 37,181
  6. Avatar for Galaxie 16. Galaxie Lv 1 27 pts. 37,121
  7. Avatar for vs 17. vs Lv 1 24 pts. 37,088
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 22 pts. 37,005
  9. Avatar for fpc 19. fpc Lv 1 20 pts. 36,960
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 18 pts. 36,914

Comments


LociOiling Lv 1

I didn't go hunting for the Hoogsteen base pair until after the puzzle expired, but it's there.

On the left, adenine in a Watson-Crick base pair. On the right, at segment 224, the adenine is in a Hoogsteen base pair.

There are two hydrogen bonds in both cases. The thymine side of the pair is in the same orientation in both.

There's also a Hoogsteen pairing for guanine and cytosine, but there wasn't one in this puzzle. The Hoogsteen G-C pairing has two hydrogen bonds, where Watston-Crick has three.

The Hoogsteen base pair article on Wikipedia has a good illustration that shows the differences between Hoogsteen and Watson-Crick.

LociOiling Lv 1

Just to complete the set, here's what the density looked like for those two pairs. The adenine in the Hoogsteen pair has a slightly better density score, but a lower overall score.