Placeholder image of a protein
Icon representing a puzzle

2466: Electron Density Reconstruction 92

Closed since almost 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
May 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNCFEMLRCDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNC

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 53,495
  2. Avatar for Contenders 2. Contenders 52 pts. 53,427
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 24 pts. 53,408
  4. Avatar for Go Science 4. Go Science 10 pts. 53,377
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 4 pts. 53,168
  6. Avatar for Marvin's bunch 6. Marvin's bunch 1 pt. 53,152
  7. Avatar for Australia 7. Australia 1 pt. 53,148
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 53,125
  9. Avatar for VeFold 9. VeFold 1 pt. 52,953

  1. Avatar for Dr.Sillem 41. Dr.Sillem Lv 1 3 pts. 52,118
  2. Avatar for pfirth 42. pfirth Lv 1 3 pts. 52,098
  3. Avatar for Merf 43. Merf Lv 1 2 pts. 51,989
  4. Avatar for silent gene 44. silent gene Lv 1 2 pts. 51,727
  5. Avatar for DScott 45. DScott Lv 1 2 pts. 51,720
  6. Avatar for Mohoernchen 46. Mohoernchen Lv 1 2 pts. 51,695
  7. Avatar for Th1sN@me!sN0tAPun 47. Th1sN@me!sN0tAPun Lv 1 2 pts. 51,690
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 51,684
  9. Avatar for DeltaConti 49. DeltaConti Lv 1 1 pt. 51,674
  10. Avatar for mario 50. mario Lv 1 1 pt. 51,673

Comments