Placeholder image of a protein
Icon representing a puzzle

2466: Electron Density Reconstruction 92

Closed since almost 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
May 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNCFEMLRCDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNC

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 53,495
  2. Avatar for Contenders 2. Contenders 52 pts. 53,427
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 24 pts. 53,408
  4. Avatar for Go Science 4. Go Science 10 pts. 53,377
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 4 pts. 53,168
  6. Avatar for Marvin's bunch 6. Marvin's bunch 1 pt. 53,152
  7. Avatar for Australia 7. Australia 1 pt. 53,148
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 53,125
  9. Avatar for VeFold 9. VeFold 1 pt. 52,953

  1. Avatar for alicemarcello 61. alicemarcello Lv 1 1 pt. 51,590
  2. Avatar for Zhao Zhipeng 62. Zhao Zhipeng Lv 1 1 pt. 51,571
  3. Avatar for phobe 63. phobe Lv 1 1 pt. 51,557
  4. Avatar for Alberto Lugaro 64. Alberto Lugaro Lv 1 1 pt. 51,550
  5. Avatar for bazoo27 65. bazoo27 Lv 1 1 pt. 51,542
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 51,522
  7. Avatar for methelzadar 67. methelzadar Lv 1 1 pt. 51,499
  8. Avatar for Tehnologik1 68. Tehnologik1 Lv 1 1 pt. 50,283
  9. Avatar for Kimdonghyeon 69. Kimdonghyeon Lv 1 1 pt. 50,167
  10. Avatar for AlphaFold2 70. AlphaFold2 Lv 1 1 pt. 48,573

Comments