Placeholder image of a protein
Icon representing a puzzle

2466: Electron Density Reconstruction 92

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
May 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNCFEMLRCDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNC

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 53,495
  2. Avatar for Contenders 2. Contenders 52 pts. 53,427
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 24 pts. 53,408
  4. Avatar for Go Science 4. Go Science 10 pts. 53,377
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 4 pts. 53,168
  6. Avatar for Marvin's bunch 6. Marvin's bunch 1 pt. 53,152
  7. Avatar for Australia 7. Australia 1 pt. 53,148
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 53,125
  9. Avatar for VeFold 9. VeFold 1 pt. 52,953

  1. Avatar for orily1337 71. orily1337 Lv 1 1 pt. 48,486
  2. Avatar for horowsah 72. horowsah Lv 1 1 pt. 44,556
  3. Avatar for Lucrece 73. Lucrece Lv 1 1 pt. 42,452
  4. Avatar for spvincent 74. spvincent Lv 1 1 pt. 42,313
  5. Avatar for agautieri 75. agautieri Lv 1 1 pt. 42,313
  6. Avatar for guineapig 76. guineapig Lv 1 1 pt. 42,313
  7. Avatar for beta_helix 77. beta_helix Lv 1 1 pt. 42,313
  8. Avatar for Serca 78. Serca Lv 1 1 pt. 42,313

Comments