2466: Electron Density Reconstruction 92

Closed since almost 2 years ago

Summary

• Created: May 09, 2024
• Expires: June 13, 2024 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

• Sequence: MNCFEMLRCDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNC

Top groups

• 1. L'Alliance Francophone 100 pts. 53,495
• 2. Contenders 52 pts. 53,427
• 3. Anthropic Dreams 24 pts. 53,408
• 4. Go Science 10 pts. 53,377
• 5. FamilyBarmettler 4 pts. 53,168
• 6. Marvin's bunch 1 pt. 53,152
• 7. Australia 1 pt. 53,148
• 8. Void Crushers 1 pt. 53,125
• 9. VeFold 1 pt. 52,953

Top soloists

• 31. Matteo Sidoti 9 pts. 52,766
• 32. vybi 8 pts. 52,745
• 33. zbp 7 pts. 52,738
• 34. jausmh 7 pts. 52,720
• 35. Nicolo' Malerba 6 pts. 52,693
• 36. luca.mangalaviti 5 pts. 52,648
• 37. Giovanni Franco 5 pts. 52,563
• 38. maithra 4 pts. 52,411
• 39. hada 4 pts. 52,360
• 40. abiogenesis 3 pts. 52,173