Placeholder image of a protein
Icon representing a puzzle

2460: Refine Density Reconstruction 2

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2258, which was Reconstruction Puzzle 25, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density.

Sequence
MHHHHHHENLYFQGAASMLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFSKALDDDEIIELVDKSFGMVRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIPYEKLEELGYGDLISHFDK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 76,004
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 52 pts. 75,690
  3. Avatar for Contenders 3. Contenders 24 pts. 74,165
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 10 pts. 73,370
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 4 pts. 73,226
  6. Avatar for Marvin's bunch 6. Marvin's bunch 1 pt. 70,830
  7. Avatar for VeFold 7. VeFold 1 pt. 68,518
  8. Avatar for Australia 8. Australia 1 pt. 66,276
  9. Avatar for Foldit Staff 9. Foldit Staff 1 pt. 0
  1. Avatar for Pinteger 51. Pinteger Lv 1 1 pt. 52,447
  2. Avatar for Kimdonghyeon 52. Kimdonghyeon Lv 1 1 pt. 49,936
  3. Avatar for osc 53. osc Lv 1 1 pt. 46,115
  4. Avatar for Arne Heessels 54. Arne Heessels Lv 1 1 pt. 41,946
  5. Avatar for beta_helix 55. beta_helix Lv 1 1 pt. 0
  6. Avatar for mengzach 56. mengzach Lv 1 1 pt. 0
  7. Avatar for spvincent 57. spvincent Lv 1 1 pt. 0
  8. Avatar for rmoretti 58. rmoretti Lv 1 1 pt. 0
  9. Avatar for hada 59. hada Lv 1 1 pt. 0
  10. Avatar for roarshock 60. roarshock Lv 1 1 pt. 0

Comments

LociOiling Lv 1

PDB 7CTO is a good match. It has six chains with the same sequence, give or take a few aminos. (Edit: misread my AA Edit results.)

LociOiling Lv 1

I must learn to read the puzzle comments. I see a mention of Puzzle 2258, and now it all makes sense. (They might have included that link in the puzzle comments….)

Puzzle 2258 was also diagnosed as having 7CTO, plus a few missing residues. Looks like this puzzle has the same issues. The problem is that the two residues on either side of the missing ones are just joined up. The result is a "straw", residues with stretched bonds and horrible ideality.

When there are missing residues, there should be a break in the chain, versus trying to join up the sides of the gap like nothing happened.

Bruno Kestemont Lv 1

There is quite something wrong with this puzzle, in the memory and CPU usages. Sometimes high memory usage just by opening. After some recipe run, it seems to breack CPU usage.

Bruno Kestemont Lv 1

There was less problem with Puzzle 2258.
I could run up to 3 parallel clients on it. 2460 is limited to 1 client.