Icon representing a puzzle

2462: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Go Science 100 pts. 10,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 10,610
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 10,543
  4. Avatar for Contenders 4. Contenders 14 pts. 10,407
  5. Avatar for Void Crushers 5. Void Crushers 6 pts. 10,271
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 10,169
  7. Avatar for Australia 7. Australia 1 pt. 10,158
  8. Avatar for VeFold 8. VeFold 1 pt. 10,095
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,033
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,011

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,657
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,610
  3. Avatar for blazegeek 3. blazegeek Lv 1 88 pts. 10,568
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 10,555
  5. Avatar for orily1337 5. orily1337 Lv 1 76 pts. 10,543
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 71 pts. 10,501
  7. Avatar for Marvelz 7. Marvelz Lv 1 66 pts. 10,435
  8. Avatar for akaaka 8. akaaka Lv 1 61 pts. 10,414
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 56 pts. 10,407
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 52 pts. 10,351

Comments