Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for grogar7 11. grogar7 Lv 1 50 pts. 10,057
  2. Avatar for fpc 12. fpc Lv 1 46 pts. 10,057
  3. Avatar for MicElephant 13. MicElephant Lv 1 43 pts. 10,048
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 40 pts. 10,030
  5. Avatar for g_b 15. g_b Lv 1 37 pts. 10,017
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 34 pts. 9,994
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 31 pts. 9,980
  8. Avatar for georg137 18. georg137 Lv 1 29 pts. 9,967
  9. Avatar for vs 19. vs Lv 1 26 pts. 9,956
  10. Avatar for Galaxie 20. Galaxie Lv 1 24 pts. 9,952

Comments