Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for Kiwegapa 31. Kiwegapa Lv 1 9 pts. 9,733
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 8 pts. 9,710
  3. Avatar for maithra 33. maithra Lv 1 7 pts. 9,680
  4. Avatar for alcor29 34. alcor29 Lv 1 6 pts. 9,633
  5. Avatar for NPrincipi 35. NPrincipi Lv 1 6 pts. 9,629
  6. Avatar for hada 36. hada Lv 1 5 pts. 9,586
  7. Avatar for Vinara 37. Vinara Lv 1 5 pts. 9,581
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 4 pts. 9,572
  9. Avatar for vybi 39. vybi Lv 1 4 pts. 9,545
  10. Avatar for Th1sN@me!sN0tAPun 40. Th1sN@me!sN0tAPun Lv 1 3 pts. 9,542

Comments