Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for heather-1 41. heather-1 Lv 1 3 pts. 9,527
  2. Avatar for Gerom 42. Gerom Lv 1 3 pts. 9,506
  3. Avatar for TheGUmmer 43. TheGUmmer Lv 1 2 pts. 9,497
  4. Avatar for silent gene 44. silent gene Lv 1 2 pts. 9,467
  5. Avatar for goldfish80 45. goldfish80 Lv 1 2 pts. 9,359
  6. Avatar for stomjoh 46. stomjoh Lv 1 2 pts. 9,353
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 1 pt. 9,335
  8. Avatar for Ikuso 48. Ikuso Lv 1 1 pt. 9,333
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 9,294
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 9,288

Comments