Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for zo3xiaJonWeinberg 51. zo3xiaJonWeinberg Lv 1 1 pt. 9,267
  2. Avatar for bazoo27 52. bazoo27 Lv 1 1 pt. 9,257
  3. Avatar for rosie4loop 53. rosie4loop Lv 1 1 pt. 9,236
  4. Avatar for zbp 54. zbp Lv 1 1 pt. 9,215
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 9,175
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 9,163
  7. Avatar for SuperEnzyme 57. SuperEnzyme Lv 1 1 pt. 9,145
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,101
  9. Avatar for MasterTrainerPK 59. MasterTrainerPK Lv 1 1 pt. 8,961
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 8,956

Comments