Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 8,531
  2. Avatar for frostschutz 72. frostschutz Lv 1 1 pt. 8,524
  3. Avatar for jflat06 73. jflat06 Lv 1 1 pt. 6,495
  4. Avatar for lumabe 74. lumabe Lv 1 1 pt. 5,079
  5. Avatar for Arne Heessels 75. Arne Heessels Lv 1 1 pt. 2,942
  6. Avatar for spvincent 76. spvincent Lv 1 1 pt. 2,942
  7. Avatar for kotenok2000 77. kotenok2000 Lv 1 1 pt. 2,942

Comments