Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506

  1. Avatar for grogar7 11. grogar7 Lv 1 50 pts. 10,057
  2. Avatar for fpc 12. fpc Lv 1 46 pts. 10,057
  3. Avatar for MicElephant 13. MicElephant Lv 1 43 pts. 10,048
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 40 pts. 10,030
  5. Avatar for g_b 15. g_b Lv 1 37 pts. 10,017
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 34 pts. 9,994
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 31 pts. 9,980
  8. Avatar for georg137 18. georg137 Lv 1 29 pts. 9,967
  9. Avatar for vs 19. vs Lv 1 26 pts. 9,956
  10. Avatar for Galaxie 20. Galaxie Lv 1 24 pts. 9,952

Comments