Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506
  1. Avatar for Kiwegapa 31. Kiwegapa Lv 1 9 pts. 9,733
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 8 pts. 9,710
  3. Avatar for maithra 33. maithra Lv 1 7 pts. 9,680
  4. Avatar for alcor29 34. alcor29 Lv 1 6 pts. 9,633
  5. Avatar for NPrincipi 35. NPrincipi Lv 1 6 pts. 9,629
  6. Avatar for hada 36. hada Lv 1 5 pts. 9,586
  7. Avatar for Vinara 37. Vinara Lv 1 5 pts. 9,581
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 4 pts. 9,572
  9. Avatar for vybi 39. vybi Lv 1 4 pts. 9,545
  10. Avatar for Th1sN@me!sN0tAPun 40. Th1sN@me!sN0tAPun Lv 1 3 pts. 9,542

Comments