Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506

  1. Avatar for heather-1 41. heather-1 Lv 1 3 pts. 9,527
  2. Avatar for Gerom 42. Gerom Lv 1 3 pts. 9,506
  3. Avatar for TheGUmmer 43. TheGUmmer Lv 1 2 pts. 9,497
  4. Avatar for silent gene 44. silent gene Lv 1 2 pts. 9,467
  5. Avatar for goldfish80 45. goldfish80 Lv 1 2 pts. 9,359
  6. Avatar for stomjoh 46. stomjoh Lv 1 2 pts. 9,353
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 1 pt. 9,335
  8. Avatar for Ikuso 48. Ikuso Lv 1 1 pt. 9,333
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 9,294
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 9,288

Comments