Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506

  1. Avatar for zo3xiaJonWeinberg 51. zo3xiaJonWeinberg Lv 1 1 pt. 9,267
  2. Avatar for bazoo27 52. bazoo27 Lv 1 1 pt. 9,257
  3. Avatar for rosie4loop 53. rosie4loop Lv 1 1 pt. 9,236
  4. Avatar for zbp 54. zbp Lv 1 1 pt. 9,215
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 9,175
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 9,163
  7. Avatar for SuperEnzyme 57. SuperEnzyme Lv 1 1 pt. 9,145
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,101
  9. Avatar for MasterTrainerPK 59. MasterTrainerPK Lv 1 1 pt. 8,961
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 8,956

Comments