Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506

  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 8,531
  2. Avatar for frostschutz 72. frostschutz Lv 1 1 pt. 8,524
  3. Avatar for jflat06 73. jflat06 Lv 1 1 pt. 6,495
  4. Avatar for lumabe 74. lumabe Lv 1 1 pt. 5,079
  5. Avatar for Arne Heessels 75. Arne Heessels Lv 1 1 pt. 2,942
  6. Avatar for spvincent 76. spvincent Lv 1 1 pt. 2,942
  7. Avatar for kotenok2000 77. kotenok2000 Lv 1 1 pt. 2,942

Comments