Placeholder image of a protein
Icon representing a puzzle

2469: Electron Density Reconstruction 93

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNLFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNVAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNPKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTDSLRMLQQKRWDEAAANLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 28,931
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 28,908
  3. Avatar for Window Group 13. Window Group 1 pt. 22,664
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 22,499
  1. Avatar for Vinara 41. Vinara Lv 1 1 pt. 28,595
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 1 pt. 28,451
  3. Avatar for altaris 43. altaris Lv 1 1 pt. 28,412
  4. Avatar for DScott 44. DScott Lv 1 1 pt. 28,410
  5. Avatar for silent gene 45. silent gene Lv 1 1 pt. 28,407
  6. Avatar for Mohoernchen 46. Mohoernchen Lv 1 1 pt. 28,389
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 28,384
  8. Avatar for messier81 48. messier81 Lv 1 1 pt. 28,325
  9. Avatar for Arne Heessels 49. Arne Heessels Lv 1 1 pt. 28,321
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 28,312

Comments