Placeholder image of a protein
Icon representing a puzzle

2469: Electron Density Reconstruction 93

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNLFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNVAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNPKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTDSLRMLQQKRWDEAAANLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 29,320
  2. Avatar for Go Science 2. Go Science 68 pts. 29,293
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 29,289
  4. Avatar for Contenders 4. Contenders 27 pts. 29,278
  5. Avatar for Australia 5. Australia 16 pts. 29,182
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 29,165
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 29,128
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 29,085
  9. Avatar for VeFold 9. VeFold 1 pt. 29,044
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 28,995

  1. Avatar for grogar7 11. grogar7 Lv 1 38 pts. 29,226
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 34 pts. 29,204
  3. Avatar for Sandrix72 13. Sandrix72 Lv 1 30 pts. 29,200
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 27 pts. 29,191
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 24 pts. 29,182
  6. Avatar for vs 16. vs Lv 1 22 pts. 29,179
  7. Avatar for fpc 17. fpc Lv 1 19 pts. 29,165
  8. Avatar for alcor29 18. alcor29 Lv 1 17 pts. 29,160
  9. Avatar for NPrincipi 19. NPrincipi Lv 1 15 pts. 29,159
  10. Avatar for jausmh 20. jausmh Lv 1 13 pts. 29,159

Comments