Placeholder image of a protein
Icon representing a puzzle

2469: Electron Density Reconstruction 93

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNLFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNVAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNPKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTDSLRMLQQKRWDEAAANLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 29,320
  2. Avatar for Go Science 2. Go Science 68 pts. 29,293
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 29,289
  4. Avatar for Contenders 4. Contenders 27 pts. 29,278
  5. Avatar for Australia 5. Australia 16 pts. 29,182
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 29,165
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 29,128
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 29,085
  9. Avatar for VeFold 9. VeFold 1 pt. 29,044
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 28,995

  1. Avatar for akaaka 21. akaaka Lv 1 11 pts. 29,154
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 10 pts. 29,141
  3. Avatar for TheGUmmer 23. TheGUmmer Lv 1 9 pts. 29,128
  4. Avatar for georg137 24. georg137 Lv 1 8 pts. 29,107
  5. Avatar for Steven Pletsch 25. Steven Pletsch Lv 1 7 pts. 29,091
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 6 pts. 29,085
  7. Avatar for BarrySampson 27. BarrySampson Lv 1 5 pts. 29,044
  8. Avatar for rosie4loop 28. rosie4loop Lv 1 4 pts. 29,019
  9. Avatar for Trajan464 29. Trajan464 Lv 1 4 pts. 29,015
  10. Avatar for Artoria2e5 30. Artoria2e5 Lv 1 3 pts. 29,009

Comments