Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 12,719

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 22,460
  2. Avatar for LociOiling 2. LociOiling Lv 1 91 pts. 22,449
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 82 pts. 22,438
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 74 pts. 22,412
  5. Avatar for Galaxie 5. Galaxie Lv 1 66 pts. 22,393
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 60 pts. 22,390
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 53 pts. 22,387
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 48 pts. 22,378
  9. Avatar for fpc 9. fpc Lv 1 42 pts. 22,375
  10. Avatar for TheGUmmer 10. TheGUmmer Lv 1 38 pts. 22,353

Comments