Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 22,461
  2. Avatar for Go Science 2. Go Science 60 pts. 22,460
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 22,390
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 22,375
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 22,353
  6. Avatar for Australia 6. Australia 4 pts. 22,292
  7. Avatar for Contenders 7. Contenders 2 pts. 22,283
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 22,215
  9. Avatar for VeFold 9. VeFold 1 pt. 22,056
  10. Avatar for Russian team 10. Russian team 1 pt. 21,681

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 22,461
  2. Avatar for LociOiling 2. LociOiling Lv 1 33 pts. 22,461
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 8 pts. 22,457
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 2 pts. 22,430
  5. Avatar for alcor29 6. alcor29 Lv 1 1 pt. 22,377

Comments