Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 22,461
  2. Avatar for Go Science 2. Go Science 60 pts. 22,460
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 22,390
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 22,375
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 22,353
  6. Avatar for Australia 6. Australia 4 pts. 22,292
  7. Avatar for Contenders 7. Contenders 2 pts. 22,283
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 22,215
  9. Avatar for VeFold 9. VeFold 1 pt. 22,056
  10. Avatar for Russian team 10. Russian team 1 pt. 21,681
  1. Avatar for Vinara 41. Vinara Lv 1 1 pt. 21,401
  2. Avatar for Arne Heessels 42. Arne Heessels Lv 1 1 pt. 21,368
  3. Avatar for osc 43. osc Lv 1 1 pt. 21,356
  4. Avatar for DScott 44. DScott Lv 1 1 pt. 21,332
  5. Avatar for juanda097 45. juanda097 Lv 1 1 pt. 21,260
  6. Avatar for rinze 46. rinze Lv 1 1 pt. 21,234
  7. Avatar for DrBabs 47. DrBabs Lv 1 1 pt. 21,121
  8. Avatar for furi0us 48. furi0us Lv 1 1 pt. 21,049
  9. Avatar for Swapper242 49. Swapper242 Lv 1 1 pt. 20,948
  10. Avatar for platinum9091 50. platinum9091 Lv 1 1 pt. 20,868

Comments