Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 6,384
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,355
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 92 pts. 11,355
  3. Avatar for Serca 3. Serca Lv 1 85 pts. 11,345
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 78 pts. 11,261
  5. Avatar for blazegeek 5. blazegeek Lv 1 71 pts. 11,217
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 65 pts. 11,158
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 59 pts. 11,149
  8. Avatar for WBarme1234 8. WBarme1234 Lv 1 54 pts. 11,095
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 49 pts. 11,071
  10. Avatar for Marvelz 10. Marvelz Lv 1 44 pts. 11,067

Comments