Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,809
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 11,797
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 87 pts. 11,774
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 81 pts. 11,727
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 11,717
  6. Avatar for Galaxie 6. Galaxie Lv 1 70 pts. 11,708
  7. Avatar for blazegeek 7. blazegeek Lv 1 65 pts. 11,697
  8. Avatar for grogar7 8. grogar7 Lv 1 60 pts. 11,688
  9. Avatar for Aubade01 9. Aubade01 Lv 1 56 pts. 11,675
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 51 pts. 11,668

Comments