Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870

  1. Avatar for drumpeter18yrs9yrs 21. drumpeter18yrs9yrs Lv 1 20 pts. 11,574
  2. Avatar for NPrincipi 22. NPrincipi Lv 1 18 pts. 11,559
  3. Avatar for BarrySampson 23. BarrySampson Lv 1 16 pts. 11,524
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 15 pts. 11,503
  5. Avatar for maithra 25. maithra Lv 1 13 pts. 11,483
  6. Avatar for alcor29 26. alcor29 Lv 1 12 pts. 11,483
  7. Avatar for jausmh 27. jausmh Lv 1 11 pts. 11,472
  8. Avatar for Steven Pletsch 28. Steven Pletsch Lv 1 10 pts. 11,459
  9. Avatar for AlphaFold2 29. AlphaFold2 Lv 1 9 pts. 11,429
  10. Avatar for Th1sN@me!sN0tAPun 30. Th1sN@me!sN0tAPun Lv 1 8 pts. 11,427

Comments