Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870

  1. Avatar for hada 31. hada Lv 1 7 pts. 11,413
  2. Avatar for juanda097 32. juanda097 Lv 1 6 pts. 11,404
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 6 pts. 11,360
  4. Avatar for Alistair69 34. Alistair69 Lv 1 5 pts. 11,346
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 4 pts. 11,338
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 4 pts. 11,337
  7. Avatar for Larini 37. Larini Lv 1 3 pts. 11,322
  8. Avatar for Tian00 38. Tian00 Lv 1 3 pts. 11,308
  9. Avatar for heather-1 39. heather-1 Lv 1 3 pts. 11,302
  10. Avatar for zbp 40. zbp Lv 1 2 pts. 11,291

Comments