Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870

  1. Avatar for pfirth 41. pfirth Lv 1 2 pts. 11,252
  2. Avatar for Pibeagles1 42. Pibeagles1 Lv 1 2 pts. 11,210
  3. Avatar for Trajan464 43. Trajan464 Lv 1 2 pts. 11,198
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 1 pt. 11,184
  5. Avatar for Merf 45. Merf Lv 1 1 pt. 11,113
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 11,092
  7. Avatar for mwm64 47. mwm64 Lv 1 1 pt. 11,065
  8. Avatar for jsfoldingaccount 48. jsfoldingaccount Lv 1 1 pt. 11,014
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 10,969
  10. Avatar for DScott 50. DScott Lv 1 1 pt. 10,950

Comments