Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870

  1. Avatar for Ikuso 51. Ikuso Lv 1 1 pt. 10,937
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 10,930
  3. Avatar for KRUK94 53. KRUK94 Lv 1 1 pt. 10,916
  4. Avatar for zo3xiaJonWeinberg 54. zo3xiaJonWeinberg Lv 1 1 pt. 10,911
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 1 pt. 10,904
  6. Avatar for frostschutz 56. frostschutz Lv 1 1 pt. 10,898
  7. Avatar for Thalyum 57. Thalyum Lv 1 1 pt. 10,897
  8. Avatar for Marvelz 58. Marvelz Lv 1 1 pt. 10,897
  9. Avatar for Alphatest 59. Alphatest Lv 1 1 pt. 10,859
  10. Avatar for artsyambie6 60. artsyambie6 Lv 1 1 pt. 10,828

Comments