Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870
  1. Avatar for wil_low 61. wil_low Lv 1 1 pt. 10,805
  2. Avatar for Sammy3c2b1a0 62. Sammy3c2b1a0 Lv 1 1 pt. 10,788
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 10,775
  4. Avatar for julienbouysset 64. julienbouysset Lv 1 1 pt. 10,748
  5. Avatar for Kimdonghyeon 65. Kimdonghyeon Lv 1 1 pt. 10,688
  6. Avatar for TheCatMeow 66. TheCatMeow Lv 1 1 pt. 10,230
  7. Avatar for raspberryenthusiast 67. raspberryenthusiast Lv 1 1 pt. 9,817
  8. Avatar for osc 68. osc Lv 1 1 pt. 9,788
  9. Avatar for hookedwarm 69. hookedwarm Lv 1 1 pt. 9,320
  10. Avatar for Eclegv 70. Eclegv Lv 1 1 pt. 8,075

Comments