Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870
  1. Avatar for jflat06 71. jflat06 Lv 1 1 pt. 7,870
  2. Avatar for JasQueL 72. JasQueL Lv 1 1 pt. 7,731

Comments