Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,812
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,804
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,653
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,642
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,632
  6. Avatar for Australia 6. Australia 11 pts. 11,615
  7. Avatar for Contenders 7. Contenders 7 pts. 11,589
  8. Avatar for VeFold 8. VeFold 4 pts. 11,524
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 2 pts. 11,503
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,065
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,812
  2. Avatar for Galaxie 2. Galaxie Lv 1 24 pts. 11,804
  3. Avatar for LociOiling 3. LociOiling Lv 1 4 pts. 11,802
  4. Avatar for alcor29 4. alcor29 Lv 1 1 pt. 11,744
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 1 pt. 11,711

Comments