Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,812
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,804
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,653
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,642
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,632
  6. Avatar for Australia 6. Australia 11 pts. 11,615
  7. Avatar for Contenders 7. Contenders 7 pts. 11,589
  8. Avatar for VeFold 8. VeFold 4 pts. 11,524
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 2 pts. 11,503
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,065
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 47 pts. 11,653
  2. Avatar for TheGUmmer 12. TheGUmmer Lv 1 44 pts. 11,642
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 40 pts. 11,638
  4. Avatar for fpc 14. fpc Lv 1 37 pts. 11,632
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 34 pts. 11,619
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 31 pts. 11,615
  7. Avatar for g_b 17. g_b Lv 1 28 pts. 11,612
  8. Avatar for orily1337 18. orily1337 Lv 1 26 pts. 11,595
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 24 pts. 11,589
  10. Avatar for akaaka 20. akaaka Lv 1 22 pts. 11,587

Comments