Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,886
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,776
  3. Avatar for Team China 13. Team China 1 pt. 9,607
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 9,427
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,426
  6. Avatar for Window Group 16. Window Group 1 pt. 8,206
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,737
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,289
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 10,265
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 10,259
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 10,246
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 77 pts. 10,242
  6. Avatar for grogar7 6. grogar7 Lv 1 71 pts. 10,234
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 66 pts. 10,233
  8. Avatar for Galaxie 8. Galaxie Lv 1 62 pts. 10,232
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 57 pts. 10,228
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 53 pts. 10,224

Comments