Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,289
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,259
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 10,233
  4. Avatar for Contenders 4. Contenders 36 pts. 10,224
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,221
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,169
  7. Avatar for Australia 7. Australia 10 pts. 10,168
  8. Avatar for VeFold 8. VeFold 6 pts. 10,134
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 10,098
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,080

  1. Avatar for firejuggler 51. firejuggler Lv 1 1 pt. 9,782
  2. Avatar for alyssa_d_V2.0 52. alyssa_d_V2.0 Lv 1 1 pt. 9,776
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 9,772
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 9,700
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 9,640
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 9,607
  7. Avatar for zo3xiaJonWeinberg 57. zo3xiaJonWeinberg Lv 1 1 pt. 9,607
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 9,580
  9. Avatar for KRUK94 59. KRUK94 Lv 1 1 pt. 9,552
  10. Avatar for Kimdonghyeon 60. Kimdonghyeon Lv 1 1 pt. 9,542

Comments