Placeholder image of a protein
Icon representing a puzzle

2487: Electron Density Reconstruction 99

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 24, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 51,874
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 51,838
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 50,235
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 20,179
  1. Avatar for christioanchauvin
    1. christioanchauvin Lv 1
    100 pts. 53,737
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 53,587
  3. Avatar for Galaxie 3. Galaxie Lv 1 86 pts. 53,544
  4. Avatar for gmn 4. gmn Lv 1 79 pts. 53,469
  5. Avatar for grogar7 5. grogar7 Lv 1 73 pts. 53,388
  6. Avatar for fpc 6. fpc Lv 1 67 pts. 53,377
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 62 pts. 53,367
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 57 pts. 53,360
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 52 pts. 53,308
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 47 pts. 53,302

Comments