Placeholder image of a protein
Icon representing a puzzle

2487: Electron Density Reconstruction 99

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
July 24, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 53,737
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 53,643
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 53,377
  4. Avatar for Go Science 4. Go Science 27 pts. 53,367
  5. Avatar for Contenders 5. Contenders 16 pts. 53,308
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 53,189
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 53,134
  8. Avatar for Australia 8. Australia 3 pts. 52,805
  9. Avatar for VeFold 9. VeFold 1 pt. 52,459
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 52,150

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 53,643
  2. Avatar for LociOiling 2. LociOiling Lv 1 24 pts. 53,569
  3. Avatar for alcor29 3. alcor29 Lv 1 4 pts. 53,431
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 1 pt. 53,301

Comments