Placeholder image of a protein
Icon representing a puzzle

2493: Electron Density Reconstruction 100

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 06, 2024
Expires
Max points
100
Description

Reconstruction Puzzle 100! We made it this far, congrats all! The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 85,121
  2. Avatar for Go Science 2. Go Science 56 pts. 84,892
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 84,757
  4. Avatar for Australia 4. Australia 14 pts. 84,478
  5. Avatar for Contenders 5. Contenders 6 pts. 83,937
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 83,829
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 83,682
  8. Avatar for VeFold 8. VeFold 1 pt. 82,952
  9. Avatar for Extraterrestrials 2.0 9. Extraterrestrials 2.0 1 pt. 78,891
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 68,100

  1. Avatar for zanbato 41. zanbato Lv 1 1 pt. 78,891
  2. Avatar for KRUK94 42. KRUK94 Lv 1 1 pt. 78,523
  3. Avatar for DScott 43. DScott Lv 1 1 pt. 78,518
  4. Avatar for rinze 44. rinze Lv 1 1 pt. 78,507
  5. Avatar for Arne Heessels 45. Arne Heessels Lv 1 1 pt. 78,432
  6. Avatar for nicobul 46. nicobul Lv 1 1 pt. 78,379
  7. Avatar for chaperoneKaty 47. chaperoneKaty Lv 1 1 pt. 78,166
  8. Avatar for manu8170 48. manu8170 Lv 1 1 pt. 77,429
  9. Avatar for xeronine 49. xeronine Lv 1 1 pt. 77,076
  10. Avatar for Kimdonghyeon 50. Kimdonghyeon Lv 1 1 pt. 76,750

Comments