Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Window Group 11. Window Group 1 pt. 5,522

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,815
  2. Avatar for grogar7 2. grogar7 Lv 1 93 pts. 10,802
  3. Avatar for LociOiling 3. LociOiling Lv 1 86 pts. 10,777
  4. Avatar for Punzi Baker 3 4. Punzi Baker 3 Lv 1 80 pts. 10,756
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 74 pts. 10,751
  6. Avatar for SemperRabbit 6. SemperRabbit Lv 1 68 pts. 10,741
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 63 pts. 10,735
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 58 pts. 10,727
  9. Avatar for g_b 9. g_b Lv 1 53 pts. 10,718
  10. Avatar for Galaxie 10. Galaxie Lv 1 49 pts. 10,707

Comments