Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Go Science 100 pts. 10,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,804
  3. Avatar for Contenders 3. Contenders 33 pts. 10,676
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 10,598
  5. Avatar for Australia 5. Australia 8 pts. 10,517
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 10,459
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 10,453
  8. Avatar for VeFold 8. VeFold 1 pt. 10,294
  9. Avatar for Extraterrestrials 2.0 9. Extraterrestrials 2.0 1 pt. 10,023
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,966

  1. Avatar for Merf 41. Merf Lv 1 1 pt. 9,748
  2. Avatar for KRUK94 42. KRUK94 Lv 1 1 pt. 9,747
  3. Avatar for carxo 43. carxo Lv 1 1 pt. 9,719
  4. Avatar for zbp 44. zbp Lv 1 1 pt. 9,685
  5. Avatar for AlphaFold2 45. AlphaFold2 Lv 1 1 pt. 9,641
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 9,614
  7. Avatar for Mohoernchen 47. Mohoernchen Lv 1 1 pt. 9,611
  8. Avatar for nicobul 48. nicobul Lv 1 1 pt. 9,604
  9. Avatar for nancy_annys 49. nancy_annys Lv 1 1 pt. 9,594
  10. Avatar for Swapper242 50. Swapper242 Lv 1 1 pt. 9,525

Comments