Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,804
  3. Avatar for Contenders 3. Contenders 33 pts. 10,676
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 10,598
  5. Avatar for Australia 5. Australia 8 pts. 10,517
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 10,459
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 10,453
  8. Avatar for VeFold 8. VeFold 1 pt. 10,294
  9. Avatar for Extraterrestrials 2.0 9. Extraterrestrials 2.0 1 pt. 10,023
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,966
  1. Avatar for NeLikomSheet 31. NeLikomSheet Lv 1 5 pts. 10,239
  2. Avatar for Alistair69 32. Alistair69 Lv 1 5 pts. 10,236
  3. Avatar for JuliaBCollet 33. JuliaBCollet Lv 1 4 pts. 10,164
  4. Avatar for maithra 34. maithra Lv 1 4 pts. 10,114
  5. Avatar for zanbato 35. zanbato Lv 1 3 pts. 10,023
  6. Avatar for jsfoldingaccount 36. jsfoldingaccount Lv 1 3 pts. 9,956
  7. Avatar for nancy_naniewoo 37. nancy_naniewoo Lv 1 2 pts. 9,901
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 2 pts. 9,854
  9. Avatar for ppp6 39. ppp6 Lv 1 2 pts. 9,798
  10. Avatar for Arne Heessels 40. Arne Heessels Lv 1 2 pts. 9,792

Comments