Placeholder image of a protein
Icon representing a puzzle

2496: Electron Density Reconstruction 101

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
August 09, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 47,868
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 45,822

  1. Avatar for Aubade01 11. Aubade01 Lv 1 43 pts. 50,351
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 39 pts. 50,314
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 36 pts. 50,284
  4. Avatar for alcor29 14. alcor29 Lv 1 33 pts. 50,243
  5. Avatar for SemperRabbit 15. SemperRabbit Lv 1 30 pts. 50,132
  6. Avatar for fpc 16. fpc Lv 1 27 pts. 50,121
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 24 pts. 49,850
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 22 pts. 49,828
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 20 pts. 49,820
  10. Avatar for rosie4loop 20. rosie4loop Lv 1 18 pts. 49,575

Comments