Placeholder image of a protein
Icon representing a puzzle

2496: Electron Density Reconstruction 101

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
August 09, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 47,868
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 45,822

  1. Avatar for manu8170 21. manu8170 Lv 1 16 pts. 49,451
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 14 pts. 49,449
  3. Avatar for vs 23. vs Lv 1 13 pts. 49,394
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 11 pts. 49,387
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 10 pts. 49,276
  6. Avatar for NeLikomSheet 26. NeLikomSheet Lv 1 9 pts. 49,257
  7. Avatar for drumpeter18yrs9yrs 27. drumpeter18yrs9yrs Lv 1 8 pts. 49,242
  8. Avatar for JuliaBCollet 28. JuliaBCollet Lv 1 7 pts. 49,150
  9. Avatar for nicobul 29. nicobul Lv 1 6 pts. 49,124
  10. Avatar for akaaka 30. akaaka Lv 1 5 pts. 49,029

Comments