Placeholder image of a protein
Icon representing a puzzle

2496: Electron Density Reconstruction 101

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
August 09, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 47,868
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 45,822

  1. Avatar for BarrySampson 31. BarrySampson Lv 1 5 pts. 48,969
  2. Avatar for maithra 32. maithra Lv 1 4 pts. 48,857
  3. Avatar for nancy_naniewoo 33. nancy_naniewoo Lv 1 4 pts. 48,789
  4. Avatar for Trajan464 34. Trajan464 Lv 1 3 pts. 48,699
  5. Avatar for hada 35. hada Lv 1 3 pts. 48,476
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 2 pts. 48,428
  7. Avatar for ppp6 37. ppp6 Lv 1 2 pts. 48,312
  8. Avatar for zbp 38. zbp Lv 1 2 pts. 48,302
  9. Avatar for alyssa_d_V2.0 39. alyssa_d_V2.0 Lv 1 2 pts. 48,060
  10. Avatar for zanbato 40. zanbato Lv 1 1 pt. 47,868

Comments